Transcript | Ll_transcript_18721 |
---|---|
CDS coordinates | 359-772 (+) |
Peptide sequence | MVKLPDSPNRAKILKVILAKEELSPDINLDAIASMTDGYSGSDLKNLCVAAAHHPIKEILEKEKKDRAAALAEGRPAPSLCSSGDIRPLNNDDFKYAHQHVCASVSSESVNMTELLQWNELYGEGGSRVKKSLSYFM* |
ORF Type | complete |
Blastp | ATPase family AAA domain-containing protein 1-A from Danio with 32.2% of identity |
---|---|
Blastx | ATPase family AAA domain-containing protein 1-A from Danio with 33.02% of identity |
Eggnog | Aaa atpase(COG0464) |
Kegg | Link to kegg annotations (368672) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014508990.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer