Protein coding transcript 183843

• Transcript: Ll_transcript_18721
• CDS coordinates: 359-772 (+)
• Peptide sequence: MVKLPDSPNRAKILKVILAKEELSPDINLDAIASMTDGYSGSDLKNLCVAAAHHPIKEILEKEKKDRAAALAEGRPAPSLCSSGDIRPLNNDDFKYAHQHVCASVSSESVNMTELLQWNELYGEGGSRVKKSLSYFM*
• ORF Type: complete

Annotations of Ll_transcript_18721

• Blastp: ATPase family AAA domain-containing protein 1-A from Danio with 32.2% of identity
• Blastx: ATPase family AAA domain-containing protein 1-A from Danio with 33.02% of identity
• Eggnog: Aaa atpase(COG0464)
• Kegg: Link to kegg annotations (368672)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014508990.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;