Transcript | Ll_transcript_18735 |
---|---|
CDS coordinates | 89-682 (+) |
Peptide sequence | MLGQRENSGEHEAMRKMKNEFMVNWDGLRTKDTERVLVLAATNRPFDLDEAVIRRLPRRLMVKLPDSPNRAKILKVILAKEELSPDINLDAIASMTDGYSGSDLKNLCVAAAHHPIKEILEKEKKDRAAALAEGRPAPSLCSSGDIRPLNNDDFKYAHQHVCASVSSESVNMTELLQWNELYGEGGSRVKKSLSYFM* |
ORF Type | complete |
Blastp | ATPase family AAA domain-containing protein 1-A from Danio with 36.99% of identity |
---|---|
Blastx | ATPase family AAA domain-containing protein 1-A from Danio with 37.36% of identity |
Eggnog | Aaa atpase(COG0464) |
Kegg | Link to kegg annotations (368672) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014508990.1) |
Pfam | ATPase family associated with various cellular activities (AAA) (PF00004.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer