Protein coding transcript 183867

• Transcript: Ll_transcript_16645
• CDS coordinates: 796-1488 (+)
• Peptide sequence: MDNLSFPLLCPDWNADEEMLLLEGIEMYGSGNWNEVAEYVGTKSKSQCIDHYNAVYMNSPCFPLADLSHVMGKSREELLALAKGREVKKEFPLSAELTPKEEPPFSEGINSEESKIAETTNQTMSKLSSVCSKTYSSSIKKASNMSQNDDGVKVEGIFSKVCLKVIVSSIFVIRDCISFDATMLFFVEINERKRKRSEIYDVIHLSQLNYTVEASLFMLSVILTTTIIIT*
• ORF Type: complete

Annotations of Ll_transcript_16645

• Blastp: Transcriptional adapter ADA2 from Oryza sativa with 58.06% of identity
• Blastx: Transcriptional adapter ADA2 from Oryza sativa with 65.2% of identity
• Eggnog: transcriptional(COG5114)
• Kegg: Link to kegg annotations (4334126)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438739.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;