Protein coding transcript 183872

• Transcript: Ll_transcript_17191
• CDS coordinates: 1-687 (+)
• Peptide sequence: IDKLQPTFRQWENTPDAGERVHLSKEVLAGCESIEWQVDELDKAIAVASRDPSWYGIDEVEIENRKRWTSSARAQVRTVKKAAEAEKGPNKTNHASVNGMHRELMRHPNSHQSDISNNYVTQNSDDFIESESDRQMLLIKKQDEELDELTLSVQRIGGVGLTIHEELLAQEKIIDELGSEMDSTSNRLDFVQKKVGMIMKKASAKGQIMMILGLLALFIFLFILVFFT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_17191

• Blastp: Syntaxin-61 from Arabidopsis with 65.5% of identity
• Blastx: Syntaxin-61 from Arabidopsis with 65.4% of identity
• Eggnog: syntaxin(ENOG410ZZA3)
• Kegg: Link to kegg annotations (AT1G28490)
• CantataDB: Link to cantataDB annotations (CNT0002625)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435598.1)
• Pfam: Syntaxin 6, N-terminal (PF09177.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;