Transcript | Ll_transcript_17184 |
---|---|
CDS coordinates | 1072-1461 (+) |
Peptide sequence | MHQELMRLPNSHQTDTYNQYAAQDNDDFIQSESDRQMLLIKRQDEELDELTLSVQRIGGVGLTIHEELIGQERIIDELGSEMDSTSNRLNFVQKKVAMVMKKASAKGQIMMILGLFALFIFLFILVFFT* |
ORF Type | complete |
Blastp | Syntaxin-61 from Arabidopsis with 72.09% of identity |
---|---|
Blastx | Syntaxin-61 from Arabidopsis with 70.37% of identity |
Eggnog | syntaxin(ENOG410ZZA3) |
Kegg | Link to kegg annotations (AT1G28490) |
CantataDB | Link to cantataDB annotations (CNT0000374) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440725.1) |
Pfam | SNARE domain (PF05739.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer