| Transcript | Ll_transcript_17189 |
|---|---|
| CDS coordinates | 936-1253 (+) |
| Peptide sequence | MHQELMRLPNSHQTDTYNQYAAQDNDDFIQSESDRQMLLIKRQDEELDELTLSVQRIGGVGLTIHEELIGQERIIDELGSEMDSTSNRLNFVQVSFCFICSPNCL* |
| ORF Type | complete |
| Blastp | Syntaxin-61 from Arabidopsis with 72.04% of identity |
|---|---|
| Blastx | Syntaxin-61 from Arabidopsis with 59.83% of identity |
| Eggnog | syntaxin(ENOG410ZZA3) |
| Kegg | Link to kegg annotations (AT1G28490) |
| CantataDB | Link to cantataDB annotations (CNT0000374) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019440726.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer