Protein coding transcript 183885

• Transcript: Ll_transcript_17201
• CDS coordinates: 2-634 (+)
• Peptide sequence: FLTQHTQCMTFFLSSLIRTCSTRSSFSFLPFSNSNLEFFLSFLSIPPTFLTSHFLRVAQRFHPRGGKMTPFISLSLLLLLLQFPLPSLSTNFEGNALHALRTKLSDPNNVLHSWDPTLVNPCTWFHVTCDSNNHVIRLDLGNSNISGVLGPELGQLHHLQYLELYNNDFTGKIPEELGNLKSLISMDLYGNKFEGKIPKSFGKLKSLKFL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_17201

• Blastp: Leucine-rich repeat protein 2 from Arabidopsis with 66.43% of identity
• Blastx: Leucine-rich repeat protein 2 from Arabidopsis with 72.48% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT3G43740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441493.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;