Protein coding transcript 183899

• Transcript: Ll_transcript_18079
• CDS coordinates: 1065-2078 (+)
• Peptide sequence: MGSEHLPGRSCRKPLGIQIIEYWKGSRVSFKTHQAIVLIVTFLAYASYHVTRKTSSIVKSALDPKSPDLGMNFLPLRLTNFSETNVPRRFSGVLGGGWAPFNGTDGTSLLGQLDVAFLSVYAFGMYFSGHFGDRCNLRIFLTVGMLGTGVFTSLFGAGYWGDIHNFYYFLVVQMIAGLLQSTGWPSVVAVLGNWFGKGKRGLIMGVWNAHTSVGNIAGSLIASAMLKYGWGWSFVLPGLVMALIGFVVFLTLPVTPESVGADKDEDEYSFPKKNRDGGIEEPLLRPYTPLVEDKAVGFTEAWKIPGVAPFALCLFFSKLVAYTFLYWLPFYVSHTGN*
• ORF Type: complete

Annotations of Ll_transcript_18079

• Blastp: Putative glycerol-3-phosphate transporter 1 from Arabidopsis with 67.68% of identity
• Blastx: Putative glycerol-3-phosphate transporter 1 from Arabidopsis with 67.89% of identity
• Eggnog: transporter(COG2271)
• Kegg: Link to kegg annotations (AT3G47420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450861.1)
• Pfam: Major Facilitator Superfamily (PF07690.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;