Protein coding transcript 18392

• Transcript: Ll_transcript_393020
• CDS coordinates: 3-509 (+)
• Peptide sequence: QKLKLPKGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCGQKTILFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGDGKCWTTKVTCEEELIEAIGTATGEKKDCFCFIEVIAHKDDTSKELLEWGSRVCSANSRPPNPQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_393020

• Blastp: Pyruvate decarboxylase 2 from Pisum with 92.26% of identity
• Blastx: Pyruvate decarboxylase 2 from Pisum with 92.26% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462139.1)
• Pfam: Thiamine pyrophosphate enzyme, C-terminal TPP binding domain (PF02775.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;