Protein coding transcript 183961

• Transcript: Ll_transcript_18294
• CDS coordinates: 2-535 (+)
• Peptide sequence: HCFRKKASLVEERREKMDEEEHEVYGGEIPDVEGDHDNPDVDMSAADDDAAAVKELDEMKRRLKEMEEEAAALREMQAKVEKEIGSVQDPAAASQVNKEEADARSVFVGNGYSYYQGFIVSSGTLVLYFVGDETCVFLHSNFIVVKKVKRMRRKNMKASEKKKRKTNEKTFYKRKIE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_18294

• Blastp: Polyadenylate-binding protein 3 from Arabidopsis with 76.53% of identity
• Blastx: Polyadenylate-binding protein 2 from Arabidopsis with 84% of identity
• Eggnog: Polyadenylate-binding protein(ENOG4111PFV)
• Kegg: Link to kegg annotations (AT5G10350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004504101.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;