Transcript | Ll_transcript_18309 |
---|---|
CDS coordinates | 79-381 (+) |
Peptide sequence | MDDEEHEVYGGEIPDVEGDHDNPDVDMSAADDDAAAVKELDEMKRRLKEMEEEAAALREMQAKVEKGIGSVQDPAAAASSQANKEESDTRSAFAGNVDYAC |
ORF Type | 3prime_partial |
Blastp | Polyadenylate-binding protein 3 from Arabidopsis with 71.84% of identity |
---|---|
Blastx | Polyadenylate-binding protein 2 from Arabidopsis with 67.31% of identity |
Eggnog | Polyadenylate-binding protein(ENOG4111PFV) |
Kegg | Link to kegg annotations (AT5G10350) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462161.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer