Protein coding transcript 183969

• Transcript: Ll_transcript_18296
• CDS coordinates: 55-399 (+)
• Peptide sequence: MSAADDDAAVKELDEMKRRLKEMEEEAAALREMQAKVEKEIGSVQDPAAAASLANKEEADTRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTDNFGQPKGFAYVEFVEVEAV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_18296

• Blastp: Polyadenylate-binding protein 3 from Arabidopsis with 82.76% of identity
• Blastx: Polyadenylate-binding protein 2 from Arabidopsis with 73.81% of identity
• Eggnog: Polyadenylate-binding protein(ENOG4111PFV)
• Kegg: Link to kegg annotations (AT5G10350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463812.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;