| Transcript | Ll_transcript_17291 |
|---|---|
| CDS coordinates | 249-818 (+) |
| Peptide sequence | MVTDAKRVRWKLAPTRREQDKWDRATKAATGGSEVMFRELRRSREDPKVQAAKAEEQYAKIKRKLQLLTLGIGGIGLVSAYVSYSPEIAASFGAGFLGSLAYIRMLSTSVDSLRTDGARALVKGAIGQPRLLVPVVLVMVYNRWNGILVPEYGFMHLELIPMLVGFFTYKIATFAQAIENAVTVAVEDE* |
| ORF Type | complete |
| Blastp | ATP synthase protein I from Synechococcus with 32.76% of identity |
|---|---|
| Blastx | - |
| Eggnog | - |
| Kegg | Link to kegg annotations (syc1183_c) |
| CantataDB | Link to cantataDB annotations (CNT0002162) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019413983.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer