Transcript | Ll_transcript_17295 |
---|---|
CDS coordinates | 490-954 (+) |
Peptide sequence | MFRELRRSREDPKVQAAKAEEQYAKIKRKLQLLTLGIGGIGLVSAYVSYSPEIAASFGAGFLGSLAYIRMLSTSVDSLRTDGARALVKGAIGQPRLLVPVVLVMVYNRWNGILVPEYGFMHLELIPMLVGFFTYKIATFAQAIENAVTVAVEDE* |
ORF Type | complete |
Blastp | ATP synthase protein I from Synechococcus with 32.76% of identity |
---|---|
Blastx | - |
Eggnog | - |
Kegg | Link to kegg annotations (syc1183_c) |
CantataDB | Link to cantataDB annotations (CNT0002162) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413983.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer