Protein coding transcript 184144

• Transcript: Ll_transcript_17312
• CDS coordinates: 2094-2435 (+)
• Peptide sequence: MKPFLLLNHPDTVLNSGQVDSNHSMAHASYPHGDPFYDGSLAAYGPQAISQSQMLPQMLGLASTRVALPLDLAEDGPIYVNAKQYHGILRRRQSRAKLEAQNKLIKSRKVFSV*
• ORF Type: complete

Annotations of Ll_transcript_17312

• Blastp: Nuclear transcription factor Y subunit A-3 from Arabidopsis with 53.93% of identity
• Blastx: Nuclear transcription factor Y subunit A-3 from Arabidopsis with 55.17% of identity
• Eggnog: Nuclear transcription factor Y(COG5224)
• Kegg: Link to kegg annotations (AT1G72830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415530.1)
• Pfam: CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B (PF02045.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;