Protein coding transcript 184147

• Transcript: Ll_transcript_17315
• CDS coordinates: 475-1173 (+)
• Peptide sequence: MKPFLLLNHPDTVLNSGQVDSNHSMAHASYPHGDPFYDGSLAAYGPQAISQSQMLPQMLGLASTRVALPLDLAEDGPIYVNAKQYHGILRRRQSRAKLEAQNKLIKSRKPYLHESRHRHALNRVRGSGGRFLSTKQLQQSNAEHVNGAHSGSDPVNKYQKKDATEGKSHPTRTGENASSITICSDWTHFSNNSISYRQPEHIFPGNSTNIGEHHSGSGLAFGGTQQRAPVVR*
• ORF Type: complete

Annotations of Ll_transcript_17315

• Blastp: Nuclear transcription factor Y subunit A-3 from Arabidopsis with 46.81% of identity
• Blastx: Nuclear transcription factor Y subunit A-3 from Arabidopsis with 46.81% of identity
• Eggnog: Nuclear transcription factor Y(COG5224)
• Kegg: Link to kegg annotations (AT1G72830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415530.1)
• Pfam: CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B (PF02045.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;