Protein coding transcript 184164

• Transcript: Ll_transcript_19305
• CDS coordinates: 1196-1738 (+)
• Peptide sequence: MCQTYSDFFNWNKVKIRYCDGASFAGHPESEIKKGSGLFFRGQIIWEAIMDELLSIGMSKAKQALLSGCSAGGLATLIHCDDFREFFPKEATVKCLADAGFFLDEKDILGNSTMRSFYHDVAQLQGVVKSLQKDCIAKMEPFKCLFPLEIIKNIKTPVFLVHPAYDFWQVSSLSRHVTLL*
• ORF Type: complete

Annotations of Ll_transcript_19305

• Blastp: Pectin acetylesterase 5 from Arabidopsis with 71.34% of identity
• Blastx: Pectin acetylesterase 5 from Arabidopsis with 71.34% of identity
• Eggnog: pectinacetylesterase(ENOG410XQKD)
• Kegg: Link to kegg annotations (AT3G09410)
• CantataDB: Link to cantataDB annotations (CNT0001012)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431276.1)
• Pfam: Pectinacetylesterase (PF03283.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;