Protein coding transcript 184178

• Transcript: Ll_transcript_19312
• CDS coordinates: 406-1038 (+)
• Peptide sequence: MDELLSIGMSKAKQALLSGCSAGGLATLIHCDDFREFFPKEATVKCLADAGFFLDEKDILGNSTMRSFYHDVAQLQGVVKSLQKDCIAKMEPFKCLFPLEIIKNIKTPVFLVHPAYDFWQIHNILVPQGSDPHGHWKRCRLNLLNCNANEIEILHHFRTSLLKAVNEFQQREEIGMFIDSCFIHCQTLMEETWHSPNSPRINDKTIADSVA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_19312

• Blastp: Pectin acetylesterase 5 from Arabidopsis with 63.03% of identity
• Blastx: Pectin acetylesterase 5 from Arabidopsis with 64.78% of identity
• Eggnog: pectinacetylesterase(ENOG410XQKD)
• Kegg: Link to kegg annotations (AT3G09410)
• CantataDB: Link to cantataDB annotations (CNT0001012)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431276.1)
• Pfam: Pectinacetylesterase (PF03283.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;