Protein coding transcript 1842

• Transcript: Ll_transcript_491603
• CDS coordinates: 275-955 (+)
• Peptide sequence: MALSPFALKILHQRVSMSVSSSLKKRWGGNNEFLRRFSSATNDKGKSEGTEVVVSEGKRNRLLPKKKGNRRWLWRNDEYHFPPALNDFFPSSLGNALMQATKNINNLFDTMNITPWSLNGRIKEKVDHYKLSYNMPGISKDDVKITIDDGLLRIKGEHKEENEEKDDNDGDEYWSSSSYGYYNTSIVLPNDAKVDEIKAQLKDGVLIVTIPRSEKPKNDVKEVIVH*
• ORF Type: complete

Annotations of Ll_transcript_491603

• Blastp: 26.5 kDa heat shock protein, mitochondrial from Arabidopsis with 50% of identity
• Blastx: 26.5 kDa heat shock protein, mitochondrial from Arabidopsis with 47.86% of identity
• Eggnog: response to heat(COG0071)
• Kegg: Link to kegg annotations (AT1G52560)
• CantataDB: Link to cantataDB annotations (CNT0001388)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442436.1)
• Pfam: Hsp20/alpha crystallin family (PF00011.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;