Transcript | Ll_transcript_17794 |
---|---|
CDS coordinates | 398-799 (+) |
Peptide sequence | MNQRDLQTKMEQEERRRIADITDAQIKRWAAGKEGNMRALLSTLQNVLWPECGWQPVSLTDMITSTSVKKVYRKATLCVHPDKVQQKGATLEQKYTAEKVFDILKVYLKCLWKTIYFRVNTHFGPYKFLRGSN* |
ORF Type | complete |
Blastp | Auxilin-related protein 1 from Arabidopsis with 76.92% of identity |
---|---|
Blastx | Auxilin-related protein 2 from Arabidopsis with 74.55% of identity |
Eggnog | DnaJ domain(ENOG410YDCT) |
Kegg | Link to kegg annotations (AT4G12780) |
CantataDB | Link to cantataDB annotations (CNT0002085) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438587.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer