Protein coding transcript 184208

• Transcript: Ll_transcript_17785
• CDS coordinates: 398-751 (+)
• Peptide sequence: MNQRDLQTKMEQEERRRIADITDAQIKRWAAGKEGNMRALLSTLQNVLWPECGWQPVSLTDMITSTSVKKVYRKATLCVHPDKVQQKGATLEQKYTAEKVFDILKEAWTKFNKEELS*
• ORF Type: complete

Annotations of Ll_transcript_17785

• Blastp: Auxilin-related protein 1 from Arabidopsis with 77.39% of identity
• Blastx: Auxilin-related protein 2 from Arabidopsis with 75.21% of identity
• Eggnog: DnaJ domain(ENOG410YDCT)
• Kegg: Link to kegg annotations (AT4G12780)
• CantataDB: Link to cantataDB annotations (CNT0002085)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438587.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;