Transcript | Ll_transcript_17454 |
---|---|
CDS coordinates | 184-960 (+) |
Peptide sequence | MKFWKILSNQIEQTLPEWRDKFLSYKDLKKQLKLIDPNHSSLQLSKEVKDFLNFLEFEIHKFNSFFVDKEEEYIIKFKELQDRVSGAKDSNMELMSLWREIVDFHGEMVLLENYSALNYTGLVKIIKKYDKRTGALIRQPFIQDVLNQPFFKTDVLNKLVKECEVMLSILFPKNRPLSPSLSISKSYEDDGCGSITADENKETLVQVPKELAEIENMENMFIKLTQSALQTLEQIRGGSSTVSMYSLPPLHNKALEEA* |
ORF Type | complete |
Blastp | SPX domain-containing protein 2 from Arabidopsis with 56.16% of identity |
---|---|
Blastx | SPX domain-containing protein 2 from Arabidopsis with 55.17% of identity |
Eggnog | Vacuolar transporter chaperone(COG5036) |
Kegg | Link to kegg annotations (AT2G26660) |
CantataDB | Link to cantataDB annotations (CNT0001723) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438769.1) |
Pfam | SPX domain (PF03105.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer