Transcript | Ll_transcript_491604 |
---|---|
CDS coordinates | 133-591 (+) |
Peptide sequence | MKQVNIFCVLVLDFFPSSLGNALMQATKNINNLFDTMNITPWSLNGRIKEKVDHYKLSYNMPGISKDDVKITIDDGLLRIKGEHKEENEEKDDNDGDEYWSSSSYGYYNTSIVLPNDAKVDEIKAQLKDGVLIVTIPRSEKPKNDVKEVIVH* |
ORF Type | complete |
Blastp | 26.5 kDa heat shock protein, mitochondrial from Arabidopsis with 56.85% of identity |
---|---|
Blastx | 26.5 kDa heat shock protein, mitochondrial from Arabidopsis with 53.42% of identity |
Eggnog | response to heat(COG0071) |
Kegg | Link to kegg annotations (AT1G52560) |
CantataDB | Link to cantataDB annotations (CNT0001388) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442436.1) |
Pfam | Hsp20/alpha crystallin family (PF00011.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer