Protein coding transcript 184362

• Transcript: Ll_transcript_17084
• CDS coordinates: 3-488 (+)
• Peptide sequence: LTDESNVQPVKSPVTICGDIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRHPQRITILRGNHESRQITQVYGFYDECLRKYGSANVWKIFTDLFDFFPLTALVESEIFCLHGGLSPSIETLDNIRNFDRVQEVPHEGPMCDLLW
• ORF Type: internal

Annotations of Ll_transcript_17084

• Blastp: Serine/threonine-protein phosphatase PP2A catalytic subunit from Medicago with 98.77% of identity
• Blastx: Serine/threonine-protein phosphatase PP2A catalytic subunit from Medicago with 98.77% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425414.1)
• Pfam: Calcineurin-like phosphoesterase (PF00149.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;