Transcript | Ll_transcript_17091 |
---|---|
CDS coordinates | 935-1237 (+) |
Peptide sequence | MCDLLWSDPDDRCGWGISPRGAGYTFGQDISEQFNHTNSLKLIARAHQLVMDGFNWAHEQKVVTIFSAPNYCYRCGNMASILEVDDCKNHTFIQVSFFCI* |
ORF Type | complete |
Blastp | Serine/threonine-protein phosphatase PP2A catalytic subunit from Medicago with 98.94% of identity |
---|---|
Blastx | Serine/threonine-protein phosphatase PP2A catalytic subunit from Medicago with 98.69% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455478.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer