Transcript | Ll_transcript_17082 |
---|---|
CDS coordinates | 1-573 (+) |
Peptide sequence | KSPVTICGDIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQVYGFYDECLRKYGSANVWKIFTDLFDFFPLTALVESEIFCLHGGLSPSIETLDNIRNFDRVQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDISEQFNHTNSLKLIAR |
ORF Type | internal |
Blastp | Serine/threonine-protein phosphatase PP2A catalytic subunit from Medicago with 100% of identity |
---|---|
Blastx | Serine/threonine-protein phosphatase PP2A catalytic subunit from Medicago with 100% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_013450302.1) |
Pfam | Calcineurin-like phosphoesterase (PF00149.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer