Protein coding transcript 184375

• Transcript: Ll_transcript_16818
• CDS coordinates: 27-401 (+)
• Peptide sequence: MIMPSSSERKCGYVIFDYKTYTCLMDILCRTEESGVIPIPENTTSRDVPTEHVQPENDVPEQQAVTVAKPKYRHEFYQKPDEVVVTIFAKGIPRNSITVDFGEQIVWFFHLYLINAFYFILLCYY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_16818

• Blastp: Protein SGT1 homolog A from Arabidopsis with 72.22% of identity
• Blastx: Protein SGT1 homolog A from Arabidopsis with 72.22% of identity
• Eggnog: Suppressor of g2 allele of skp1(COG5091)
• Kegg: Link to kegg annotations (AT4G23570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452778.1)
• Pfam: CS domain (PF04969.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;