Protein coding transcript 184378

• Transcript: Ll_transcript_16823
• CDS coordinates: 207-1004 (+)
• Peptide sequence: MASDLELKAKEAFVDDHYDLAVELLTQAIQLSPNNAHLYADRAQANIKLHNLTEAVADANKAIELNPSLSKAYFRKGTACLKLEEYQTAKAAFVIGASLAPGESRFTNLIKECDELIAEESGVIPIPENTTSRDVPTEHVQPENDVPEQQAVTVAKPKYRHEFYQKPDEVVVTIFAKGIPRNSITVDFGEQILSVIINVPGTDIYTFQPRLFGKITPAKCRFEVLSTKIEIRLAKAELIHWTSLEFSGGVIVPQRVNFSSGNFRF*
• ORF Type: complete

Annotations of Ll_transcript_16823

• Blastp: Protein SGT1 homolog from Oryza sativa with 59.39% of identity
• Blastx: Protein SGT1 homolog from Oryza sativa with 59.39% of identity
• Eggnog: Suppressor of g2 allele of skp1(COG5091)
• Kegg: Link to kegg annotations (4326682)
• CantataDB: Link to cantataDB annotations (CNT0002034)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452778.1)
• Pfam: Tetratricopeptide repeat (PF13181.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;