Transcript | Ll_transcript_17745 |
---|---|
CDS coordinates | 638-1108 (+) |
Peptide sequence | MVPKQHAEDHYFSTHAPVACSLCSETMERDILDIHKGENCPQRIVTCEFCEFPLPAIDLPKHQDVCGNRTELCHVCNKYVRLRERYSHGDSCNRIQDNSVGSSRDVRAAERDEGAQRRPQNEFSRKNLLFTIAITGVAVIVGSIFFQRKAEPSDVH* |
ORF Type | complete |
Blastp | XIAP-associated factor 1 from Homo with 34.23% of identity |
---|---|
Blastx | XIAP-associated factor 1 from Homo with 34.53% of identity |
Eggnog | XIAP associated factor 1(ENOG4110HW5) |
Kegg | Link to kegg annotations (54739) |
CantataDB | Link to cantataDB annotations (CNT0002120) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415842.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer