Protein coding transcript 184430

• Transcript: Ll_transcript_17754
• CDS coordinates: 1431-1823 (+)
• Peptide sequence: MERDILDIHKGENCPQRIVTCEFCEFPLPAIDLPKHQDVCGNRTELCHVCNKYVRLRERYSHGDSCNRIQDNSVGSSRDVRAAERDEGAQRRPQNEFSRKNLLFTIAITGVAVIVGSIFFQRKAEPSDVH*
• ORF Type: complete

Annotations of Ll_transcript_17754

• Blastp: XIAP-associated factor 1 from Homo with 33.72% of identity
• Blastx: XIAP-associated factor 1 from Homo with 34.65% of identity
• Eggnog: XIAP associated factor 1(ENOG4110HW5)
• Kegg: Link to kegg annotations (54739)
• CantataDB: Link to cantataDB annotations (CNT0000530)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415842.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;