Protein coding transcript 184432

• Transcript: Ll_transcript_17748
• CDS coordinates: 29-346 (+)
• Peptide sequence: MERDILDIHKGENCPQRIVTCEFCEFPLPAIDLPKHQDVCGNRTELCHVCNKYVRLRERYSHGDSCNRIQDNSVGSSRCQVLLVIRPTQRHDFQFTTTIFASYKL*
• ORF Type: complete

Annotations of Ll_transcript_17748

• Blastp: TRAF-type zinc finger domain-containing protein 1 from Mus with 35.21% of identity
• Blastx: XIAP-associated factor 1 from Homo with 35.44% of identity
• Eggnog: TRAF-type zinc finger domain containing 1(ENOG4111IF3)
• Kegg: Link to kegg annotations (231712)
• CantataDB: Link to cantataDB annotations (CNT0002120)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415842.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;