Protein coding transcript 184434

• Transcript: Ll_transcript_17750
• CDS coordinates: 130-567 (+)
• Peptide sequence: MESDQATSICAHCDRPIPASNIDLHYAHCSRNLQKCKVCGDMVPKQHAEDHYFSTHAPVACSLCSETMERDILDIHKGENCPQRIVTCEFCEFPLPAIDLPKHQDVCGNRTELCHVCNKYVRLRERYSHGDSCNRIQDNSVGSSR*
• ORF Type: complete

Annotations of Ll_transcript_17750

• Blastp: TRAF-type zinc finger domain-containing protein 1 from Mus with 35.56% of identity
• Blastx: XIAP-associated factor 1 from Homo with 36.5% of identity
• Eggnog: TRAF-type zinc finger domain containing 1(ENOG4111IF3)
• Kegg: Link to kegg annotations (231712)
• CantataDB: Link to cantataDB annotations (CNT0002120)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415842.1)
• Pfam: TRAF-type zinc finger (PF02176.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;