Protein coding transcript 184436

• Transcript: Ll_transcript_17752
• CDS coordinates: 638-952 (+)
• Peptide sequence: MVPKQHAEDHYFSTHAPVACSLCSETMERDILDIHKGENCPQRIVTCEFCEFPLPAIDLPKHQDVCGNRTELCHVCNKYVRLRERYSHGDSCNRIQDNSVGSSR*
• ORF Type: complete

Annotations of Ll_transcript_17752

• Blastp: XIAP-associated factor 1 from Homo with 35.79% of identity
• Blastx: XIAP-associated factor 1 from Homo with 34.07% of identity
• Eggnog: XIAP associated factor 1(ENOG4110HW5)
• Kegg: Link to kegg annotations (54739)
• CantataDB: Link to cantataDB annotations (CNT0002120)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415842.1)
• Pfam: TRAF-type zinc finger (PF02176.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;