Protein coding transcript 184480

• Transcript: Ll_transcript_17586
• CDS coordinates: 268-828 (+)
• Peptide sequence: MLDKNNNNNNTVSSGAPSSSDAPFTLSENGVSNKRKRRPAGTPDPDAEVVSLSPKTLLESDRYVCEICNQGFQRDQNLQMHRRRHKVPWKLLKRETQGMKKKVFVCPEPSCLHHDPCHALGDLVGIKKHFRRKHSNHKQWVCDKCSKGYAVQSDYKAHIKICGTRGHSCDCGRVFSRFVFIFCCMI*
• ORF Type: complete

Annotations of Ll_transcript_17586

• Blastp: Protein SHOOT GRAVITROPISM 5 from Arabidopsis with 78.45% of identity
• Blastx: Protein indeterminate-domain 14 from Arabidopsis with 86.67% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (AT2G01940)
• CantataDB: Link to cantataDB annotations (CNT0001322)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462582.1)
• Pfam: C2H2-type zinc finger (PF13912.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;