Protein coding transcript 1845

• Transcript: Ll_transcript_491578
• CDS coordinates: 1-480 (+)
• Peptide sequence: VVDECKTFFFGGHETTALAITWTLMLLAKHEDWQNQLRDEIREVVGNDKLDLSKLSGFKKMKCVMNEVLRLYPPAPNVQRQVREDIKVDNLTVPSGTNLWIDVVAMHHDTEIWGKDANEFRPERFMDDMNGGCKHKMGYLSFGFGGRMCVGRNLAFMEYN
• ORF Type: internal

Annotations of Ll_transcript_491578

• Blastp: Cytochrome P450 714A1 from Arabidopsis with 46.84% of identity
• Blastx: Cytochrome P450 714A1 from Arabidopsis with 46.84% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (AT5G24910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452791.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;