Protein coding transcript 184502

• Transcript: Ll_transcript_18931
• CDS coordinates: 3-1052 (+)
• Peptide sequence: QCEFYNNFILIFQCRPSSPLKCKAIYHSSFHLPLCSSLCSFSNNNDTHLLLSTTKIANLPLKPPTRILEEKFISLLRSCRTSQHLHQIQAQITTHGLSNNDYITPNIITTCSRLHKMVHARKLFDKMPDPNTATWNSMFRGYLQFDCYLEVFLLFGKMRCFGVVPNCFTFPMVVKCCGKVDAVREGEEVHCVVLRMGFMSNPFVGTALIDMYSMWGSVGDAYKVFGDIHERNVVAWTAIIRAYISVGDMVSARRLFDLAPVRDVILWNTLVSGYIESGDMVAARKLFDKMPGRDVMSWNTMLNGYASNGDVELFEKIFDEIPEKNVFSWNGLTGGYARNGLFFSSFGVF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_18931

• Blastp: Putative pentatricopeptide repeat-containing protein At5g37570 from Arabidopsis with 38.13% of identity
• Blastx: Pentatricopeptide repeat-containing protein At2g29760, chloroplastic from Arabidopsis with 46.2% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT5G37570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414019.1)
• Pfam: PPR repeat (PF01535.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;