Protein coding transcript 184540

• Transcript: Ll_transcript_1513
• CDS coordinates: 58-627 (+)
• Peptide sequence: MHTSTFTLSPSLSFSHQKLRTRFNPSRFQLSKTNVNVNVSSSSSSSSPSLQPWSLASSSSPSFKLRPWTSLNRFQTKATSVPESAGDAASDSGALFRTLELGALFGMWFIFNIYFNIYNKQVLKVYPFPLTITAVQFAIGTVIVSLMWGLNLYKRPKISNAQLAAILPLAMVHTLGNLFTNMSLGKVAVS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_1513

• Blastp: Phosphoenolpyruvate/phosphate translocator 1, chloroplastic from Arabidopsis with 55.72% of identity
• Blastx: Phosphoenolpyruvate/phosphate translocator 1, chloroplastic from Arabidopsis with 63.24% of identity
• Eggnog: solute carrier family 35 member(ENOG410XP1S)
• Kegg: Link to kegg annotations (AT5G33320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457000.1)
• Pfam: Triose-phosphate Transporter family (PF03151.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;