Protein coding transcript 184562

• Transcript: Ll_transcript_1292
• CDS coordinates: 1-312 (+)
• Peptide sequence: QQPTAIGNDLKEIYNTKAVLHKEFSIKDLGKLKLFLGMEVVRSTKGITLYQRKYTMDLLQQSKHLSCKPASTLIEHNHKLQADLGEPLQDATSYRRLLGKLLI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_1292

• Blastp: Uncharacterized mitochondrial protein AtMg00810 from Arabidopsis with 33.73% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 33.71% of identity
• Eggnog: Retrotransposon protein(COG2801)
• Kegg: Link to kegg annotations (ArthMp070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435911.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF07727.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;