Protein coding transcript 184570

• Transcript: Ll_transcript_1298
• CDS coordinates: 112-447 (+)
• Peptide sequence: MKIYHVPCLQDNYSYLIVDESTKDAAVVDPVEPQKILEAANFHGLNLKLVLTTHHHWDHAGGNEQIKQLVPGIKVYGGSIDNVKGCTDKVENGDKVSLGADINILSLHTPW*
• ORF Type: complete

Annotations of Ll_transcript_1298

• Blastp: Hydroxyacylglutathione hydrolase cytoplasmic from Arabidopsis with 76.36% of identity
• Blastx: Hydroxyacylglutathione hydrolase cytoplasmic from Arabidopsis with 76.36% of identity
• Eggnog: Beta-lactamase domain protein(COG0491)
• Kegg: Link to kegg annotations (AT3G10850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430954.1)
• Pfam: Metallo-beta-lactamase superfamily (PF00753.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;