Transcript | Ll_transcript_1306 |
---|---|
CDS coordinates | 112-447 (+) |
Peptide sequence | MKIYHVPCLQDNYSYLIVDESTKDAAVVDPVEPQKILEAANFHGLNLKLVLTTHHHWDHAGGNEQIKQLVPGIKVYGGSIDNVKGCTDKVENGDKVSLGADINILSLHTPW* |
ORF Type | complete |
Blastp | Hydroxyacylglutathione hydrolase cytoplasmic from Arabidopsis with 76.36% of identity |
---|---|
Blastx | Hydroxyacylglutathione hydrolase cytoplasmic from Arabidopsis with 78.23% of identity |
Eggnog | Beta-lactamase domain protein(COG0491) |
Kegg | Link to kegg annotations (AT3G10850) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430954.1) |
Pfam | Metallo-beta-lactamase superfamily (PF00753.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer