Transcript | Ll_transcript_748 |
---|---|
CDS coordinates | 545-1102 (+) |
Peptide sequence | MGRGRVIVERIENKISRQVTFSKRRSGLLKKAFELSVLCDAEIALIIFSSRGKLFQFSTSDINKIIEKYRQCCFNMSQTGDLVEHQSSQNLYEEVLKLRAKHESLEKTQRIFEGEDLGPLSMKELQSLEKQIDRTLSQARQHHMQKLTARIDELRQQVYMQPLKTKNTMKVLYVLLDFDPCEIIG* |
ORF Type | complete |
Blastp | MADS-box transcription factor 6 from Oryza sativa with 59.24% of identity |
---|---|
Blastx | MADS-box transcription factor 6 from Oryza sativa with 60% of identity |
Eggnog | Transcription factor(COG5068) |
Kegg | Link to kegg annotations (4330328) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442168.1) |
Pfam | SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer