Protein coding transcript 184593

• Transcript: Ll_transcript_752
• CDS coordinates: 117-677 (+)
• Peptide sequence: MGRGRVIVERIENKISRQVTFSKRRSGLLKKAFELSVLCDAEIALIIFSSRGKLFQFSTSDINKIIEKYRQCCFNMSQTGDLVEHQSSQNLYEEVLKLRAKHESLEKTQRIFEGEDLGPLSMKELQSLEKQIDRTLSQARQHHMQKLTARIDELRQQVQNLEGVNKQLEAKVFRSLLIIICQYMYS*
• ORF Type: complete

Annotations of Ll_transcript_752

• Blastp: MADS-box transcription factor 17 from Oryza sativa with 56.98% of identity
• Blastx: MADS-box transcription factor 6 from Oryza sativa with 56.98% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442168.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;