Protein coding transcript 184623

• Transcript: Ll_transcript_1711
• CDS coordinates: 226-642 (+)
• Peptide sequence: MGRLFVVHLEGKIYSCKHCHTHLALSEDIVSKSFHSRHGKAYLFNKVVNVSFGEKDDRQMTTGMHTVADIFCVGCGSIVGWKYETAHENSQKYKEGKSVIERFKVSGPDGSNYWINHEANGGGSDADDGQTFMHDFNI*
• ORF Type: complete

Annotations of Ll_transcript_1711

• Blastp: Protein yippee-like from Solanum with 78.91% of identity
• Blastx: Protein yippee-like from Solanum with 78.91% of identity
• Eggnog: Yippee-like(ENOG4111VJ1)
• Kegg: Link to kegg annotations (102577430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456946.1)
• Pfam: Yippee zinc-binding/DNA-binding /Mis18, centromere assembly (PF03226.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;