Protein coding transcript 184677

• Transcript: Ll_transcript_481
• CDS coordinates: 159-596 (+)
• Peptide sequence: MMKLFDAHCHLQDPRILSKTPNLIKTAQNSGVVHFVVNGVCEQDWHLVKDLAQTYPSIIPSFGLHPWYVADRSPNWFKTLKEYLDSTPSAAVGEIGVDKGSHGRTIDFSEQVGVLKQQLELAKDLNKPASVHCVRAFGDLLELMK*
• ORF Type: complete

Annotations of Ll_transcript_481

• Blastp: Uncharacterized metal-dependent hydrolase YjjV from Escherichia with 29.63% of identity
• Blastx: Uncharacterized metal-dependent hydrolase YjjV from Escherichia with 28.99% of identity
• Eggnog: tatd family(COG0084)
• Kegg: Link to kegg annotations (JW4341)
• CantataDB: Link to cantataDB annotations (CNT0000065)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442900.1)
• Pfam: TatD related DNase (PF01026.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;