| Transcript | Ll_transcript_969 |
|---|---|
| CDS coordinates | 425-730 (+) |
| Peptide sequence | MTAKINMMVPIISKIYCLCSEKVLVVRRRPHVVNGGGFVVTDYGSQRVVFRVDGCGVLGTKGELMLRDGDGDPLLLLRRKVYRILLNISFKILHFHQDLHA* |
| ORF Type | complete |
| Blastp | Protein LURP-one-related 6 from Arabidopsis with 67.12% of identity |
|---|---|
| Blastx | Protein LURP-one-related 6 from Arabidopsis with 50% of identity |
| Eggnog | LURP-one-related(ENOG410YHS0) |
| Kegg | Link to kegg annotations (AT2G05910) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019464507.1) |
| Pfam | LURP-one-related (PF04525.11) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer