Transcript | Ll_transcript_951 |
---|---|
CDS coordinates | 189-785 (+) |
Peptide sequence | MSTLNPFDLLGDDAEDPSQQIEAEQLKAAAAAAASLKRGQEEGKGASRGGQPQQGKFAQLPSKPTPPAQAVREAKTEPFRGGRGGGRGGGRGYGRGRGGFSRDFSNDENKFAATEAPANQGAFEGDAEKPSERRGYGAPRVPYRGGARRGGFSNGEGDEEGRPRRVFERHSGTGRGNGFKREGAGRGNWGTQDDEIAK* |
ORF Type | complete |
Blastp | RGG repeats nuclear RNA binding protein B from Arabidopsis with 40.8% of identity |
---|---|
Blastx | RGG repeats nuclear RNA binding protein C from Arabidopsis with 59.52% of identity |
Eggnog | SERPINE1 mRNA binding protein 1(ENOG410YBHR) |
Kegg | Link to kegg annotations (AT4G17520) |
CantataDB | Link to cantataDB annotations (CNT0001522) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460244.1) |
Pfam | Stm1 (PF09598.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer