Protein coding transcript 184756

• Transcript: Ll_transcript_1490
• CDS coordinates: 384-767 (+)
• Peptide sequence: MEKDLVADENMSNLTSASSEISASSGSKSNTVSLYSQYSSTSTDQEPLPKKKRSLPGHPDPEAEVIALSPKSLIATNRFICEICDKGFQRDQNLQLHKRGHNLPWKLKQRNSKEPLRKKVYVCPEPSC
• ORF Type: 3prime_partial

Annotations of Ll_transcript_1490

• Blastp: Protein indeterminate-domain 7 from Arabidopsis with 65.08% of identity
• Blastx: Protein indeterminate-domain 12 from Arabidopsis with 81.25% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (AT1G55110)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443109.1)
• Pfam: C2H2-type zinc finger (PF13912.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;