Protein coding transcript 184836

• Transcript: Ll_transcript_2668
• CDS coordinates: 2-733 (+)
• Peptide sequence: INRVIPGDMECGGGGGGGVNNNDPNSMVVNLQSPSTNLPLSVNGVRSSNQQQQQMQQNSHSQQRQPQIFPMSYATQMPLASTQGMRGGIMGLSAEQGMNGGGNLVQGMVGLQPGPVHVPIGSPATSDKLGKSNGDTSSVSPVPYVFNGGLRGRKNGGAVEKVIERRQRRMIKNRESAARSRARKQAYTMELEAEIAKLKEENQELQKKQEEIMEIQKNQVMEMMNLQREVKRRCLRRTLTGPW*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_2668

• Blastp: ABSCISIC ACID-INSENSITIVE 5-like protein 5 from Arabidopsis with 54.59% of identity
• Blastx: ABSCISIC ACID-INSENSITIVE 5-like protein 5 from Arabidopsis with 54.75% of identity
• Eggnog: Transcription factor(ENOG410YB2M)
• Kegg: Link to kegg annotations (AT1G45249)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417059.1)
• Pfam: Basic region leucine zipper (PF07716.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;