Transcript | Ll_transcript_2669 |
---|---|
CDS coordinates | 2-676 (+) |
Peptide sequence | INRVIPGDMECGGGGGGGVNNNDPNSMVVNLQSPSTNLPLSVNGVRSSNQQQQQMQQNSHSQQRQPQIFPMSYATQMPLASTQGMRGGIMGLSAEQGMNGGGNLVQGMVGLQPGPVHVPIGSPATSDKLGKSNGDTSSVSPVPYVFNGGLRGRKNGGAVEKVIERRQRRMIKNRESAARSRARKQAYTMELEAEIAKLKEENQELQKKQVILVLPCLAYRCRHK* |
ORF Type | 5prime_partial |
Blastp | ABSCISIC ACID-INSENSITIVE 5-like protein 5 from Arabidopsis with 54.59% of identity |
---|---|
Blastx | ABSCISIC ACID-INSENSITIVE 5-like protein 5 from Arabidopsis with 51.79% of identity |
Eggnog | Transcription factor(ENOG410YB2M) |
Kegg | Link to kegg annotations (AT1G45249) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417059.1) |
Pfam | Basic region leucine zipper (PF07716.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer