Transcript | Ll_transcript_2665 |
---|---|
CDS coordinates | 212-841 (+) |
Peptide sequence | MNFKGFGNDPGQGGSDNGAGGRPPAPGNYLARQSSVYSLTFDEFMTTMGGSGKDFGSMNMDELLKNIWTAEEVQTTGSATAIQSGTSTLGGVGIAHLQKQGSLTLPRTLSQKTVDDVWKDISKDYGGSSGSVVPNLAQAEKQPTLGEMTLEEFLVRAGVVREDAQQFSAKQNDGVLGGLGMGMGYHQQLNKVNGMTGNNTNRIGGGGGGG |
ORF Type | 3prime_partial |
Blastp | ABSCISIC ACID-INSENSITIVE 5-like protein 4 from Arabidopsis with 52.49% of identity |
---|---|
Blastx | ABSCISIC ACID-INSENSITIVE 5-like protein 4 from Arabidopsis with 60.99% of identity |
Eggnog | Abscisic acid-insensitive 5-like protein(ENOG410ZM39) |
Kegg | Link to kegg annotations (AT1G49720) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417059.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer